SCOPe 2.03: Domain d4mggc2: 4mgg C:128-367

Lineage for d4mggc2 (4mgg C:128-367)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Labrenzia aggregata [TaxId:384765] [228394] (1 PDB entry)

8. Domain d4mggc2: 4mgg C:128-367 [235619]
   Other proteins in same PDB: d4mgga1, d4mggb1, d4mggc1, d4mggd1, d4mgge1, d4mggf1, d4mggg1, d4mggh1
   automated match to d4mggf2
   complexed with cl, mg, ni

Details for d4mggc2

PDB Entry: 4mgg, 2.2 Å

PDB Description: Crystal structure of an enolase (mandelate racemase subgroup) from labrenzia aggregata iam 12614 (target nysgrc-012903) with bound mg, space group p212121

PDB Compounds: (C:) muconate lactonizing enzyme

SCOPe Domain Sequences for d4mggc2:

Sequence; same for both SEQRES and ATOM records:

>d4mggc2 c.1.11.0 (C:128-367) automated matches {Labrenzia aggregata [TaxId: 384765]}
aaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrihatrsvlkks
dllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvldevidgp
ntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggdivtaaiahl
arstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlgepvarys

Timeline for d4mggc2:

• d4mggc2 is new in SCOPe 2.03-stable
  
• d4mggc2 appears in SCOPe 2.04
  
• d4mggc2 appears in the current release, SCOPe 2.08