| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
| Protein automated matches [226831] (73 species) not a true protein |
| Species Burkholderia graminis [TaxId:396598] [227808] (2 PDB entries) |
| Domain d4mf5a2: 4mf5 A:104-234 [235610] Other proteins in same PDB: d4mf5a1, d4mf5a3 automated match to d4mf6a2 complexed with fmt, gsh |
PDB Entry: 4mf5 (more details), 1.11 Å
SCOPe Domain Sequences for d4mf5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mf5a2 a.45.1.0 (A:104-234) automated matches {Burkholderia graminis [TaxId: 396598]}
lipqdaagryeaiqwvmfqmggigpmfgqlgffhkfagkeyedkrprdryvaeskrllgv
leqrlegrewilgdqysiadiatfpwvrnligfyeagelvaiqdfpnvqralaafvarpa
vvrgldspkrg
Timeline for d4mf5a2: