SCOPe 2.05: Domain d4me7c_: 4me7 C:

Lineage for d4me7c_ (4me7 C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (3 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.2: Kid/PemK [82075] (4 proteins)
   automatically mapped to Pfam PF02452

6. Protein automated matches [228538] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [228539] (1 PDB entry)

8. Domain d4me7c_: 4me7 C: [235604]
   automated match to d4me7d_
   protein/RNA complex

Details for d4me7c_

PDB Entry: 4me7, 2.92 Å

PDB Description: crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze

PDB Compounds: (C:) mRNA interferase EndoA

SCOPe Domain Sequences for d4me7c_:

Sequence, based on SEQRES records:

>d4me7c_ b.34.6.2 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
mivkrgdvyfadlspvvgseqggvrpvlviqndignrfsptaivaaitaqiqkaklpthv
eidakrygferdsvilleqirtidkqrltdkithlddemmdkvdealqislali

Sequence, based on observed residues (ATOM records):

>d4me7c_ b.34.6.2 (C:) automated matches {Bacillus subtilis [TaxId: 224308]}
mivkrgdvyfadlspvvgsvrpvlviqndignrfsptaivaaitaqiqkaklpthveida
krygferdsvilleqirtidkqrltdkithlddemmdkvdealqislali

Timeline for d4me7c_:

• d4me7c_ first appeared in SCOPe 2.03
  
• d4me7c_ appears in SCOPe 2.04
  
• d4me7c_ is called d4me7c1 in SCOPe 2.06
  
• d4me7c_ appears in the current release, SCOPe 2.08, called d4me7c1