![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) ![]() contains insert beta-sheet subdomain and C-terminal helix |
![]() | Family b.34.6.2: Kid/PemK [82075] (4 proteins) automatically mapped to Pfam PF02452 |
![]() | Protein automated matches [228538] (6 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [228539] (1 PDB entry) |
![]() | Domain d4me7b1: 4me7 B:2-114 [235603] Other proteins in same PDB: d4me7a2, d4me7b2, d4me7c2, d4me7d2 automated match to d4me7d_ protein/RNA complex |
PDB Entry: 4me7 (more details), 2.92 Å
SCOPe Domain Sequences for d4me7b1:
Sequence, based on SEQRES records: (download)
>d4me7b1 b.34.6.2 (B:2-114) automated matches {Bacillus subtilis [TaxId: 224308]} ivkrgdvyfadlspvvgseqggvrpvlviqndignrfsptaivaaitaqiqkaklpthve idakrygferdsvilleqirtidkqrltdkithlddemmdkvdealqislali
>d4me7b1 b.34.6.2 (B:2-114) automated matches {Bacillus subtilis [TaxId: 224308]} ivkrgdvyfadlspvgvrpvlviqndignrfsptaivaaitaqiqkaklpthveidakry gferdsvilleqirtidkqrltdkithlddemmdkvdealqislali
Timeline for d4me7b1: