SCOPe 2.06: Domain d4mcue1: 4mcu E:1-188

Lineage for d4mcue1 (4mcu E:1-188)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.13: DsbA-like [100953] (4 proteins)
   contains an all-alpha subdomain insertion

6. Protein automated matches [190208] (8 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:507522] [229321] (2 PDB entries)

8. Domain d4mcue1: 4mcu E:1-188 [235598]
   Other proteins in same PDB: d4mcua2, d4mcub2, d4mcue2
   automated match to d4mcuc_

Details for d4mcue1

PDB Entry: 4mcu, 1.99 Å

PDB Description: crystal structure of disulfide oxidoreductase from klebsiella pneumoniae in reduced state

PDB Compounds: (E:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4mcue1:

Sequence; same for both SEQRES and ATOM records:

>d4mcue1 c.47.1.13 (E:1-188) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
aqitdgkqyitldkpiagepqvleffsfycphcyqfeevlhvsdnvrqklpegtkmtkyh
veflgplgkdltqawavaialgvedkitapmfeavqktqtvqsvadirkvfvdagvkged
ydaawnsfvvkslvaqqekaaadlqlqgvpamyvngkyqlnpqgmdtsnmdvfvaqyadt
vkqlvekk

Timeline for d4mcue1:

• d4mcue1 first appeared in SCOPe 2.03, called d4mcue_
  
• d4mcue1 was called d4mcue_ in SCOPe 2.05
  
• d4mcue1 appears in SCOPe 2.07
  
• d4mcue1 appears in the current release, SCOPe 2.08