Lineage for d4mcue_ (4mcu E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854195Family c.47.1.13: DsbA-like [100953] (4 protein domains)
    contains an all-alpha subdomain insertion
  6. 1854244Protein automated matches [190208] (8 species)
    not a true protein
  7. 1854263Species Klebsiella pneumoniae [TaxId:507522] [229321] (2 PDB entries)
  8. 1854268Domain d4mcue_: 4mcu E: [235598]
    automated match to d4mcuc_

Details for d4mcue_

PDB Entry: 4mcu (more details), 1.99 Å

PDB Description: crystal structure of disulfide oxidoreductase from klebsiella pneumoniae in reduced state
PDB Compounds: (E:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4mcue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mcue_ c.47.1.13 (E:) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
snaqitdgkqyitldkpiagepqvleffsfycphcyqfeevlhvsdnvrqklpegtkmtk
yhveflgplgkdltqawavaialgvedkitapmfeavqktqtvqsvadirkvfvdagvkg
edydaawnsfvvkslvaqqekaaadlqlqgvpamyvngkyqlnpqgmdtsnmdvfvaqya
dtvkqlvekk

SCOPe Domain Coordinates for d4mcue_:

Click to download the PDB-style file with coordinates for d4mcue_.
(The format of our PDB-style files is described here.)

Timeline for d4mcue_: