Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
Protein automated matches [190208] (8 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:507522] [229321] (2 PDB entries) |
Domain d4mcue_: 4mcu E: [235598] automated match to d4mcuc_ |
PDB Entry: 4mcu (more details), 1.99 Å
SCOPe Domain Sequences for d4mcue_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mcue_ c.47.1.13 (E:) automated matches {Klebsiella pneumoniae [TaxId: 507522]} snaqitdgkqyitldkpiagepqvleffsfycphcyqfeevlhvsdnvrqklpegtkmtk yhveflgplgkdltqawavaialgvedkitapmfeavqktqtvqsvadirkvfvdagvkg edydaawnsfvvkslvaqqekaaadlqlqgvpamyvngkyqlnpqgmdtsnmdvfvaqya dtvkqlvekk
Timeline for d4mcue_: