SCOPe 2.04: Domain d4mcue_: 4mcu E:

Lineage for d4mcue_ (4mcu E:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.13: DsbA-like [100953] (4 proteins)
   contains an all-alpha subdomain insertion

6. Protein automated matches [190208] (8 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:507522] [229321] (2 PDB entries)

8. Domain d4mcue_: 4mcu E: [235598]
   automated match to d4mcuc_

Details for d4mcue_

PDB Entry: 4mcu, 1.99 Å

PDB Description: crystal structure of disulfide oxidoreductase from klebsiella pneumoniae in reduced state

PDB Compounds: (E:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4mcue_:

Sequence; same for both SEQRES and ATOM records:

>d4mcue_ c.47.1.13 (E:) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
snaqitdgkqyitldkpiagepqvleffsfycphcyqfeevlhvsdnvrqklpegtkmtk
yhveflgplgkdltqawavaialgvedkitapmfeavqktqtvqsvadirkvfvdagvkg
edydaawnsfvvkslvaqqekaaadlqlqgvpamyvngkyqlnpqgmdtsnmdvfvaqya
dtvkqlvekk

Timeline for d4mcue_:

• d4mcue_ first appeared in SCOPe 2.03
  
• d4mcue_ appears in SCOPe 2.05
  
• d4mcue_ appears in the current release, SCOPe 2.08, called d4mcue1