Lineage for d4mcue1 (4mcu E:1-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878376Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2878773Protein automated matches [190208] (8 species)
    not a true protein
  7. 2878792Species Klebsiella pneumoniae [TaxId:507522] [229321] (2 PDB entries)
  8. 2878797Domain d4mcue1: 4mcu E:1-188 [235598]
    Other proteins in same PDB: d4mcua2, d4mcub2, d4mcue2
    automated match to d4mcuc_

Details for d4mcue1

PDB Entry: 4mcu (more details), 1.99 Å

PDB Description: crystal structure of disulfide oxidoreductase from klebsiella pneumoniae in reduced state
PDB Compounds: (E:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d4mcue1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mcue1 c.47.1.13 (E:1-188) automated matches {Klebsiella pneumoniae [TaxId: 507522]}
aqitdgkqyitldkpiagepqvleffsfycphcyqfeevlhvsdnvrqklpegtkmtkyh
veflgplgkdltqawavaialgvedkitapmfeavqktqtvqsvadirkvfvdagvkged
ydaawnsfvvkslvaqqekaaadlqlqgvpamyvngkyqlnpqgmdtsnmdvfvaqyadt
vkqlvekk

SCOPe Domain Coordinates for d4mcue1:

Click to download the PDB-style file with coordinates for d4mcue1.
(The format of our PDB-style files is described here.)

Timeline for d4mcue1: