Lineage for d4mc5b1 (4mc5 B:4-325)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1306141Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1306142Protein automated matches [227017] (8 species)
    not a true protein
  7. 1306149Species Influenza a virus [TaxId:11320] [228462] (6 PDB entries)
  8. 1306154Domain d4mc5b1: 4mc5 B:4-325 [235595]
    automated match to d1ha0a1
    complexed with fuc, nag

Details for d4mc5b1

PDB Entry: 4mc5 (more details), 2.24 Å

PDB Description: crystal structure of a subtype h18 hemagglutinin homologue from a/flat-faced bat/peru/033/2010 (h18n11)
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4mc5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mc5b1 b.19.1.0 (B:4-325) automated matches {Influenza a virus [TaxId: 11320]}
gdqicigyhsnnstqtvntllesnvpvtsshsilekehngllcklkgkapldlidcslpa
wlmgnpkcdelltasewayikedpepengicfpgdfdsledlillvsntdhfrkekiidm
trfsdvttnnvdsacpydtngasfyrnlnwvqqnkgkqlifhyqnsennplliiwgvhqt
snaaeqntyygsqtgsttitigeetntyplvisessilnghsdrinyfwgvvnpnqnfsi
vstgnfiwpeygyffqkttnisgiikssekisdcdticqtkigainstlpfqnihqnaig
dcpkyvkaqelvlatglrnnpi

SCOPe Domain Coordinates for d4mc5b1:

Click to download the PDB-style file with coordinates for d4mc5b1.
(The format of our PDB-style files is described here.)

Timeline for d4mc5b1: