SCOPe 2.08: Domain d2mev1_: 2mev 1:

Lineage for d2mev1_ (2mev 1:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Mengo encephalomyocarditis virus coat proteins [49678] (1 species)

7. Species Mengovirus [TaxId:12107] [49679] (2 PDB entries)

8. Domain d2mev1_: 2mev 1: [23558]
   complexed with po4

Details for d2mev1_

PDB Entry: 2mev, 3 Å

PDB Description: structural refinement and analysis of mengo virus

PDB Compounds: (1:) mengo virus coat protein (subunit vp1)

SCOPe Domain Sequences for d2mev1_:

Sequence; same for both SEQRES and ATOM records:

>d2mev1_ b.121.4.1 (1:) Mengo encephalomyocarditis virus coat proteins {Mengovirus [TaxId: 12107]}
gvenaekgvtentdatadfvaqpvylpenqtkvaffydrsspigafavksgslesgfapf
snkacpnsviltpgpqfdpaydqlrpqrlteiwgngneetsevfplktkqdysfclfspf
vyykcdlevtlsphtsgahgllvrwcptgtptkpttqvlhevsslsegrtpqvysagpgt
snqisfvvpynsplsvlpavwynghkrfdntgdlgiapnsdfgtlffagtkpdikftvyl
ryknmrvfcprptvffpwptsgdkidmt

Timeline for d2mev1_:

• d2mev1_ first appeared (with stable ids) in SCOP 1.55
  
• d2mev1_ appears in SCOPe 2.07