Lineage for d4mbxj_ (4mbx J:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1334432Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1335234Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) (S)
  5. 1335235Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins)
  6. 1335275Protein automated matches [191200] (3 species)
    not a true protein
  7. 1335282Species Human polyomavirus 9 [TaxId:943908] [229433] (4 PDB entries)
  8. 1335312Domain d4mbxj_: 4mbx J: [235571]
    automated match to d4mbxe_
    complexed with ca, edo

Details for d4mbxj_

PDB Entry: 4mbx (more details), 1.92 Å

PDB Description: Structure of unliganded B-Lymphotropic Polyomavirus VP1
PDB Compounds: (J:) Major capsid protein VP1

SCOPe Domain Sequences for d4mbxj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mbxj_ b.121.6.1 (J:) automated matches {Human polyomavirus 9 [TaxId: 943908]}
shmggvevlevrtgpdaitqieaylnprmgnnipsedlygysnsintafskasdtpnkdt
lpcysvaviklpllnedmtcdtilmweavsvktevvgisslvnlhqggkyiygsssgcvp
vqgttyhmfavggeplelqglvasstatypddvvaiknmkpgnqgldpkakalldkdgky
pvevwcpdpsknentryygsftggattppvmqftnsvttvlldengvgplckgdklflsc
adiagvhtnysetqvwrglpryfnvtlrkrivknpy

SCOPe Domain Coordinates for d4mbxj_:

Click to download the PDB-style file with coordinates for d4mbxj_.
(The format of our PDB-style files is described here.)

Timeline for d4mbxj_: