![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
![]() | Protein automated matches [190218] (22 species) not a true protein |
![]() | Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (15 PDB entries) |
![]() | Domain d4mapb_: 4map B: [235561] automated match to d4m9wa_ complexed with na |
PDB Entry: 4map (more details), 1.9 Å
SCOPe Domain Sequences for d4mapb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mapb_ d.129.3.0 (B:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]} gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht kgdakpdeeelkkgkakgeglfraiegyvlanptqy
Timeline for d4mapb_: