Lineage for d4mabb_ (4mab B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1369372Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1369704Protein automated matches [190100] (15 species)
    not a true protein
  7. 1369886Species Salmonella enterica [TaxId:90371] [229121] (1 PDB entry)
  8. 1369888Domain d4mabb_: 4mab B: [235557]
    automated match to d4mabd_
    complexed with cl, gol, k

Details for d4mabb_

PDB Entry: 4mab (more details), 1.9 Å

PDB Description: resolving cys to ala variant of salmonella alkyl hydroperoxide reductase c in its substrate-ready conformation
PDB Compounds: (B:) Alkyl hydroperoxide reductase subunit C

SCOPe Domain Sequences for d4mabb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mabb_ c.47.1.10 (B:) automated matches {Salmonella enterica [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevapakwkegeatlapsl
dlvgki

SCOPe Domain Coordinates for d4mabb_:

Click to download the PDB-style file with coordinates for d4mabb_.
(The format of our PDB-style files is described here.)

Timeline for d4mabb_: