Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (15 species) not a true protein |
Species Salmonella enterica [TaxId:90371] [229121] (1 PDB entry) |
Domain d4mabb_: 4mab B: [235557] automated match to d4mabd_ complexed with cl, gol, k |
PDB Entry: 4mab (more details), 1.9 Å
SCOPe Domain Sequences for d4mabb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mabb_ c.47.1.10 (B:) automated matches {Salmonella enterica [TaxId: 90371]} slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevapakwkegeatlapsl dlvgki
Timeline for d4mabb_:
View in 3D Domains from other chains: (mouse over for more information) d4maba_, d4mabc_, d4mabd_, d4mabe_ |