Lineage for d4ma6a_ (4ma6 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581738Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2582036Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2582438Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2582439Protein automated matches [190218] (22 species)
    not a true protein
  7. 2582652Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (15 PDB entries)
  8. 2582659Domain d4ma6a_: 4ma6 A: [235555]
    automated match to d4m9wa_
    complexed with 28e, na

Details for d4ma6a_

PDB Entry: 4ma6 (more details), 2 Å

PDB Description: Crystal structure of Ara h 8 with Epicatechin bound
PDB Compounds: (A:) Ara h 8 allergen

SCOPe Domain Sequences for d4ma6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ma6a_ d.129.3.0 (A:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
kgdakpdeeelkkgkakgeglfraiegyvlanptqy

SCOPe Domain Coordinates for d4ma6a_:

Click to download the PDB-style file with coordinates for d4ma6a_.
(The format of our PDB-style files is described here.)

Timeline for d4ma6a_: