SCOPe 2.08: Domain d4ma6a_: 4ma6 A:

Lineage for d4ma6a_ (4ma6 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Peanut (Arachis hypogaea) [TaxId:3818] [229316] (15 PDB entries)

8. Domain d4ma6a_: 4ma6 A: [235555]
   automated match to d4m9wa_
   complexed with 28e, na

Details for d4ma6a_

PDB Entry: 4ma6, 2 Å

PDB Description: Crystal structure of Ara h 8 with Epicatechin bound

PDB Compounds: (A:) Ara h 8 allergen

SCOPe Domain Sequences for d4ma6a_:

Sequence; same for both SEQRES and ATOM records:

>d4ma6a_ d.129.3.0 (A:) automated matches {Peanut (Arachis hypogaea) [TaxId: 3818]}
gvftfedeitstvppaklynamkdadsitpkiiddvksveivegnggpgtikkltivedg
etkfilhkvesideanyaynysvvggvalpptaekitfetklvegpnggsigkltlkyht
kgdakpdeeelkkgkakgeglfraiegyvlanptqy

Timeline for d4ma6a_:

• d4ma6a_ first appeared in SCOPe 2.03
  
• d4ma6a_ appears in SCOPe 2.07