SCOPe 2.06: Domain d1bev1_: 1bev 1:

Lineage for d1bev1_ (1bev 1:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Bovine enterovirus coat proteins [49676] (1 species)

7. Species Bovine enterovirus, VG-5-27 [TaxId:12064] [49677] (1 PDB entry)

8. Domain d1bev1_: 1bev 1: [23555]
   complexed with myr, so4

Details for d1bev1_

PDB Entry: 1bev, 3 Å

PDB Description: bovine enterovirus vg-5-27

PDB Compounds: (1:) bovine enterovirus coat proteins vp1 to vp4

SCOPe Domain Sequences for d1bev1_:

Sequence; same for both SEQRES and ATOM records:

>d1bev1_ b.121.4.1 (1:) Bovine enterovirus coat proteins {Bovine enterovirus, VG-5-27 [TaxId: 12064]}
qaagalvagtststhsvatdstpalqaaetgatstardesmietrtivpthgihetsves
ffgrsslvgmpllatgtsithwridfrefvqlrakmswftymrfdveftiiatsstgqnv
tteqhttyqvmyvppgapvpsnqdsfqwqsgcnpsvfadtdgppaqfsvpfmssanayst
vydgyarfmdtdpdrygilpsnflgfmyfrtledaahqvrfriyakikhtscwipraprq
apykkrynlvfsgdsdricsnrasltsy

Timeline for d1bev1_:

• d1bev1_ first appeared (with stable ids) in SCOP 1.55
  
• d1bev1_ appears in SCOPe 2.05
  
• d1bev1_ appears in SCOPe 2.07
  
• d1bev1_ appears in the current release, SCOPe 2.08