Lineage for d4m98a_ (4m98 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403213Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2403214Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 2403509Family b.81.1.0: automated matches [191560] (1 protein)
    not a true family
  6. 2403510Protein automated matches [190967] (31 species)
    not a true protein
  7. 2403642Species Neisseria gonorrhoeae [TaxId:242231] [235544] (2 PDB entries)
  8. 2403643Domain d4m98a_: 4m98 A: [235546]
    automated match to d4m9cd_

Details for d4m98a_

PDB Entry: 4m98 (more details), 1.67 Å

PDB Description: acetyltransferase domain of pglb from neisseria gonorrhoeae fa1090
PDB Compounds: (A:) Pilin glycosylation protein

SCOPe Domain Sequences for d4m98a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m98a_ b.81.1.0 (A:) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
nrklavigagghgkvvaelaaalgtygeivflddrtqgsvngfpvigttlllenslspeq
fditvavgnnrirrqitenaaalgfklpvlihpdatvspsaiigqgsvvmakavvqagsv
lkdgvivntaatvdhdclldafvhispgahlsgntrigeesrigtgacsrqqttvgsgvt
agagavivcdipdgmtvagnpakpl

SCOPe Domain Coordinates for d4m98a_:

Click to download the PDB-style file with coordinates for d4m98a_.
(The format of our PDB-style files is described here.)

Timeline for d4m98a_: