Lineage for d4m86a_ (4m86 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2092039Species Neisseria meningitidis [TaxId:272831] [228105] (3 PDB entries)
  8. 2092042Domain d4m86a_: 4m86 A: [235541]
    automated match to d4m89a_

Details for d4m86a_

PDB Entry: 4m86 (more details), 2.15 Å

PDB Description: Crystal Structure of Enoyl-Acyl Carrier Protein Reductase (FabI) from Neisseria meningitidis
PDB Compounds: (A:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d4m86a_:

Sequence, based on SEQRES records: (download)

>d4m86a_ c.2.1.2 (A:) automated matches {Neisseria meningitidis [TaxId: 272831]}
gflqgkkilitgmisersiaygiakacreqgaelaftyvvdkleervrkmaaeldselvf
rcdvasddeinqvfadlgkhwdgldglvhsigfapkealsgdfldsisreafntaheisa
yslpalakaarpmmrgrnsaivalsylgavraipnynvmgmakasleagirftaaclgke
gircngisagpiktlaasgiadfgkllghvaahnplrrnvtieevgntaafllsdlssgi
tgeityvdggysinalst

Sequence, based on observed residues (ATOM records): (download)

>d4m86a_ c.2.1.2 (A:) automated matches {Neisseria meningitidis [TaxId: 272831]}
gflqgkkilitgmisersiaygiakacreqgaelaftyvvdkleervrkmaaeldselvf
rcdvasddeinqvfadlgkhwdgldglvhsigfapkealsgdfldsisreafntaheisa
yslpalakaarpmmrgrnsaivalsylgavraipnynvmgmakasleagirftaaclgke
gircngisagpikfgkllghvaahnplrrnvtieevgntaafllsdlssgitgeityvdg
gysinalst

SCOPe Domain Coordinates for d4m86a_:

Click to download the PDB-style file with coordinates for d4m86a_.
(The format of our PDB-style files is described here.)

Timeline for d4m86a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4m86b_