Class b: All beta proteins [48724] (176 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (10 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188389] (6 PDB entries) |
Domain d4m75k_: 4m75 K: [235537] automated match to d4c92f_ protein/RNA complex; complexed with cl |
PDB Entry: 4m75 (more details), 2.95 Å
SCOPe Domain Sequences for d4m75k_:
Sequence, based on SEQRES records: (download)
>d4m75k_ b.38.1.0 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyesnnnkllnkfns dvflrgtqvmyiseq
>d4m75k_ b.38.1.0 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} svtteflsdiigktvnvklasgllysgrlesidgfmnvalssatehyekllnkfnsdvfl rgtqvmyiseq
Timeline for d4m75k_: