Class b: All beta proteins [48724] (174 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (7 species) not a true protein |
Species Saccharomyces cerevisiae [TaxId:559292] [228531] (2 PDB entries) |
Domain d4m75b_: 4m75 B: [235534] automated match to d4m78n_ protein/RNA complex; complexed with cl |
PDB Entry: 4m75 (more details), 2.95 Å
SCOPe Domain Sequences for d4m75b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m75b_ b.38.1.0 (B:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]} mlffsffktlvdqevvvelkndieikgtlqsvdqflnlkldnisstdekkyphlgsvrni firgstvryvylnknmvdtnllqdatrrevm
Timeline for d4m75b_: