Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (64 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226691] (4 PDB entries) |
Domain d4m63c1: 4m63 C:6-146 [235531] Other proteins in same PDB: d4m63c2, d4m63d2, d4m63e2 automated match to d4m63e1 complexed with atp, ca |
PDB Entry: 4m63 (more details), 2.75 Å
SCOPe Domain Sequences for d4m63c1:
Sequence, based on SEQRES records: (download)
>d4m63c1 c.55.1.0 (C:6-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfe tfntpamyvaiqavlslyasg
>d4m63c1 c.55.1.0 (C:6-146) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} aalvvdngsgmckagfagddapravfpsivgrprhqgvkdsyvgdeaqskrgiltlkypi ehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfetfntpa myvaiqavlslyasg
Timeline for d4m63c1:
View in 3D Domains from other chains: (mouse over for more information) d4m63d1, d4m63d2, d4m63e1, d4m63e2 |