![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (203 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186944] (39 PDB entries) |
![]() | Domain d4m55e_: 4m55 E: [235528] automated match to d4m55d_ complexed with nad, pop, so4, udp |
PDB Entry: 4m55 (more details), 2.86 Å
SCOPe Domain Sequences for d4m55e_:
Sequence, based on SEQRES records: (download)
>d4m55e_ c.2.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvvepl yievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastsevygdp evhpqsedywghvnpigpracydegkhvaetmcyaymkqegvevrvarifntfgprmhmn dgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlgnpeeh tilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklm
>d4m55e_ c.2.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvvepl yievdqiyhlaspnpiktlktntigtlnmlglakrvgarlllastsvaetmcyaymkqeg vevrvarifntfqyvsdlvnglvalmnsnvsspvnldikkaklm
Timeline for d4m55e_: