Lineage for d4m4yc1 (4m4y C:11-324)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2040266Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2040267Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2040314Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 protein domains)
  6. 2040315Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2040355Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2040410Domain d4m4yc1: 4m4y C:11-324 [235527]
    Other proteins in same PDB: d4m4ya2, d4m4yb1, d4m4yb2, d4m4yc2, d4m4yd_, d4m4ye2, d4m4yf_
    automated match to d4m4ye_
    complexed with nag; mutant

Details for d4m4yc1

PDB Entry: 4m4y (more details), 2.2 Å

PDB Description: Crystal structure of a 2009 H1N1 influenza virus hemagglutinin with a stabilization mutation HA2 E47G
PDB Compounds: (C:) Hemagglutinin HA1 subunit

SCOPe Domain Sequences for d4m4yc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m4yc1 b.19.1.2 (C:11-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnip

SCOPe Domain Coordinates for d4m4yc1:

Click to download the PDB-style file with coordinates for d4m4yc1.
(The format of our PDB-style files is described here.)

Timeline for d4m4yc1: