Lineage for d4m44c_ (4m44 C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1305718Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1305719Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1305764Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1305765Protein Hemagglutinin [49824] (6 species)
    includes rudiment esterase domain
  7. 1306046Species Influenza b virus [TaxId:416659] [228242] (1 PDB entry)
  8. 1306048Domain d4m44c_: 4m44 C: [235525]
    automated match to d4m44e_
    complexed with nag

Details for d4m44c_

PDB Entry: 4m44 (more details), 2.5 Å

PDB Description: Crystal structure of hemagglutinin of influenza virus B/Yamanashi/166/1998 in complex with avian-like receptor LSTa
PDB Compounds: (C:) hemagglutinin HA1

SCOPe Domain Sequences for d4m44c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m44c_ b.19.1.2 (C:) Hemagglutinin {Influenza b virus [TaxId: 416659]}
drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtktrgklcptclnc
tdldvalgrpmcvgvtpsakasilhevrpvtsgcfpimhdrtkirqlpnllrgyekirls
tqnvinaekapggpyrlgtsgscpnatsrsgffatmawavpkdnnktatnpltvevphic
tkeedqitvwgfhsddktqmknlygdsnpqkftssangvtthyvsqiggfpdqtedgglp
qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
glnkskpyytgehakaigncpiwvktplklangtkyrppakll

SCOPe Domain Coordinates for d4m44c_:

Click to download the PDB-style file with coordinates for d4m44c_.
(The format of our PDB-style files is described here.)

Timeline for d4m44c_: