![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species Butea monosperma [TaxId:56060] [189858] (2 PDB entries) |
![]() | Domain d4m3cc_: 4m3c C: [235524] automated match to d4m3ca_ complexed with abu, ca, gol, mn |
PDB Entry: 4m3c (more details), 2.5 Å
SCOPe Domain Sequences for d4m3cc_:
Sequence, based on SEQRES records: (download)
>d4m3cc_ b.29.1.1 (C:) automated matches {Butea monosperma [TaxId: 56060]} tntdsftfskfkpnqpnlkkqgdatvtssgtlqltkvdkngvpdpkslgralyaspiniw dsktgvvasfatsfrftiyapniatiadglafflapvssppkagagflglfdsavfnssy qtvavefdtyentvfldppdthigidvnsiksiktvkwdlangeaakvlitydssakllv aalvypssktsfilsdvvdlksvlpewvsigfsaatgassgyiethdvfswsfasklsfx xxxxxldlasflvan
>d4m3cc_ b.29.1.1 (C:) automated matches {Butea monosperma [TaxId: 56060]} tntdsftfskfkpnqpnlkkqgdatvtssgtlqltkvdkngvpdpkslgralyaspiniw dsktgvvasfatsfrftiyapniatiadglafflapvssppkagagflglfdsavfnssy qtvavefdtyentvfldppdthigidvnsiksiktvkwdlangeaakvlitydssakllv aalvypssktsfilsdvvdlksvlpewvsigfsaatgassgyiethdvfswsfasklsfl dlasflvan
Timeline for d4m3cc_: