Lineage for d4m3cc_ (4m3c C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042783Species Butea monosperma [TaxId:56060] [189858] (2 PDB entries)
  8. 2042789Domain d4m3cc_: 4m3c C: [235524]
    automated match to d4m3ca_
    complexed with abu, ca, gol, mn

Details for d4m3cc_

PDB Entry: 4m3c (more details), 2.5 Å

PDB Description: Structure of a binary complex between homologous tetrameric legume lectins from Butea monosperma and Spatholobus parviflorus seeds
PDB Compounds: (C:) Lectin alpha chain

SCOPe Domain Sequences for d4m3cc_:

Sequence, based on SEQRES records: (download)

>d4m3cc_ b.29.1.1 (C:) automated matches {Butea monosperma [TaxId: 56060]}
tntdsftfskfkpnqpnlkkqgdatvtssgtlqltkvdkngvpdpkslgralyaspiniw
dsktgvvasfatsfrftiyapniatiadglafflapvssppkagagflglfdsavfnssy
qtvavefdtyentvfldppdthigidvnsiksiktvkwdlangeaakvlitydssakllv
aalvypssktsfilsdvvdlksvlpewvsigfsaatgassgyiethdvfswsfasklsfx
xxxxxldlasflvan

Sequence, based on observed residues (ATOM records): (download)

>d4m3cc_ b.29.1.1 (C:) automated matches {Butea monosperma [TaxId: 56060]}
tntdsftfskfkpnqpnlkkqgdatvtssgtlqltkvdkngvpdpkslgralyaspiniw
dsktgvvasfatsfrftiyapniatiadglafflapvssppkagagflglfdsavfnssy
qtvavefdtyentvfldppdthigidvnsiksiktvkwdlangeaakvlitydssakllv
aalvypssktsfilsdvvdlksvlpewvsigfsaatgassgyiethdvfswsfasklsfl
dlasflvan

SCOPe Domain Coordinates for d4m3cc_:

Click to download the PDB-style file with coordinates for d4m3cc_.
(The format of our PDB-style files is described here.)

Timeline for d4m3cc_: