Lineage for d4m44a_ (4m44 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778493Species Influenza b virus [TaxId:416659] [228242] (1 PDB entry)
  8. 1778494Domain d4m44a_: 4m44 A: [235523]
    Other proteins in same PDB: d4m44b_, d4m44d_, d4m44f_
    automated match to d4m44e_
    complexed with nag

Details for d4m44a_

PDB Entry: 4m44 (more details), 2.5 Å

PDB Description: crystal structure of hemagglutinin of influenza virus b/yamanashi/166/1998 in complex with avian-like receptor lsta
PDB Compounds: (A:) hemagglutinin HA1

SCOPe Domain Sequences for d4m44a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m44a_ b.19.1.2 (A:) Hemagglutinin {Influenza b virus [TaxId: 416659]}
drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtktrgklcptclnc
tdldvalgrpmcvgvtpsakasilhevrpvtsgcfpimhdrtkirqlpnllrgyekirls
tqnvinaekapggpyrlgtsgscpnatsrsgffatmawavpkdnnktatnpltvevphic
tkeedqitvwgfhsddktqmknlygdsnpqkftssangvtthyvsqiggfpdqtedgglp
qsgrivvdymvqkpgktgtivyqrgillpqkvwcasgrskvikgslpligeadclhekyg
glnkskpyytgehakaigncpiwvktplklangtkyrppakll

SCOPe Domain Coordinates for d4m44a_:

Click to download the PDB-style file with coordinates for d4m44a_.
(The format of our PDB-style files is described here.)

Timeline for d4m44a_: