SCOPe 2.05: Domain d1rhi1_: 1rhi 1:

Lineage for d1rhi1_ (1rhi 1:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Rhinovirus coat proteins [49670] (5 species)

7. Species Human rhinovirus 3, (HRV-3) [TaxId:44130] [49675] (1 PDB entry)

8. Domain d1rhi1_: 1rhi 1: [23552]
   complexed with ca

Details for d1rhi1_

PDB Entry: 1rhi, 3 Å

PDB Description: human rhinovirus 3 coat protein

PDB Compounds: (1:) human rhinovirus 3 coat protein

SCOPe Domain Sequences for d1rhi1_:

Sequence; same for both SEQRES and ATOM records:

>d1rhi1_ b.121.4.1 (1:) Rhinovirus coat proteins {Human rhinovirus 3, (HRV-3) [TaxId: 44130]}
qtlasvssgpkhtqsvpaltanetgatlptrpsdnvetrttymhfngsetdvesflgraa
cvhvteiknknaagldnhrkeglfndwkinlsslvqlrkklelftyvrfdseytilatas
qpeassyssnltvqamyvppgapnpkewddytwqsasnpsvffkvgetsrfsvpfvgias
ayncfydgyshddpdtpygitvlnhmgsmafrvvnehdvhttivkirvyhrakhveawip
rapralpyvsigrtnyprdsktivkkrtnikty

Timeline for d1rhi1_:

• d1rhi1_ first appeared (with stable ids) in SCOP 1.55
  
• d1rhi1_ appears in SCOPe 2.04
  
• d1rhi1_ appears in SCOPe 2.06
  
• d1rhi1_ appears in the current release, SCOPe 2.08