SCOPe 2.05: Domain d4lx8a_: 4lx8 A:

Lineage for d4lx8a_ (4lx8 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein automated matches [190177] (6 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries)

8. Domain d4lx8a_: 4lx8 A: [235518]
   automated match to d4hnsa_
   complexed with mg

Details for d4lx8a_

PDB Entry: 4lx8, 2.2 Å

PDB Description: Crystal structure (2.2A) of Mg2+ bound CheY3 of Vibrio cholerae

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4lx8a_:

Sequence; same for both SEQRES and ATOM records:

>d4lx8a_ c.23.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
anknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld
kife

Timeline for d4lx8a_:

• d4lx8a_ first appeared in SCOPe 2.03
  
• d4lx8a_ appears in SCOPe 2.04
  
• d4lx8a_ is called d4lx8a1 in SCOPe 2.06
  
• d4lx8a_ appears in the current release, SCOPe 2.08, called d4lx8a1