Lineage for d4lx8a_ (4lx8 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1837704Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1837982Protein automated matches [190177] (6 species)
    not a true protein
  7. 1838031Species Vibrio cholerae [TaxId:666] [194701] (5 PDB entries)
  8. 1838033Domain d4lx8a_: 4lx8 A: [235518]
    automated match to d4hnsa_
    complexed with mg

Details for d4lx8a_

PDB Entry: 4lx8 (more details), 2.2 Å

PDB Description: Crystal structure (2.2A) of Mg2+ bound CheY3 of Vibrio cholerae
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d4lx8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lx8a_ c.23.1.1 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
anknmkilivddfstmrrivknllrdlgfnntqeaddgltalpmlkkgdfdfvvtdwnmp
gmqgidllkniradeelkhlpvlmitaeakreqiieaaqagvngyivkpftaatlkekld
kife

SCOPe Domain Coordinates for d4lx8a_:

Click to download the PDB-style file with coordinates for d4lx8a_.
(The format of our PDB-style files is described here.)

Timeline for d4lx8a_: