Lineage for d4lsul2 (4lsu L:108-211)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (808 PDB entries)
  8. 2352877Domain d4lsul2: 4lsu L:108-211 [235515]
    Other proteins in same PDB: d4lsul1
    automated match to d2fb4l2
    complexed with cl, edo, epe, nag

Details for d4lsul2

PDB Entry: 4lsu (more details), 2.3 Å

PDB Description: Crystal structure of broadly and potently neutralizing antibody VRC-PG20 in complex with HIV-1 clade A/E 93TH057 gp120
PDB Compounds: (L:) light chain of antibody vrc-pg20

SCOPe Domain Sequences for d4lsul2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lsul2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshksyscqvthegstvektvaptec

SCOPe Domain Coordinates for d4lsul2:

Click to download the PDB-style file with coordinates for d4lsul2.
(The format of our PDB-style files is described here.)

Timeline for d4lsul2: