Lineage for d4lsql2 (4lsq L:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750425Domain d4lsql2: 4lsq L:108-213 [235511]
    Other proteins in same PDB: d4lsql1
    automated match to d1n0xl2
    complexed with bu3, cd, cl, na, nag; mutant

Details for d4lsql2

PDB Entry: 4lsq (more details), 2.25 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc- ch31 in complex with hiv-1 clade a/e gp120 93th057 with loop d and loop v5 from clade a strain 3415_v1_c1
PDB Compounds: (L:) light chain of antibody vrc-ch31 with n70d mutation

SCOPe Domain Sequences for d4lsql2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lsql2 b.1.1.2 (L:108-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d4lsql2:

Click to download the PDB-style file with coordinates for d4lsql2.
(The format of our PDB-style files is described here.)

Timeline for d4lsql2: