Lineage for d4lsql1 (4lsq L:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519496Domain d4lsql1: 4lsq L:1-107 [235510]
    Other proteins in same PDB: d4lsql2
    automated match to d1n0xl1
    complexed with bu3, cd, cl, na, nag; mutant

Details for d4lsql1

PDB Entry: 4lsq (more details), 2.25 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc- ch31 in complex with hiv-1 clade a/e gp120 93th057 with loop d and loop v5 from clade a strain 3415_v1_c1
PDB Compounds: (L:) light chain of antibody vrc-ch31 with n70d mutation

SCOPe Domain Sequences for d4lsql1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lsql1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsaslgdrvtitcqasrgigkdlnwyqqkagkapkllvsdastleggvps
rfsgsgfhqdfsltisslqaedvatyfcqqyetfgqgtkvdik

SCOPe Domain Coordinates for d4lsql1:

Click to download the PDB-style file with coordinates for d4lsql1.
(The format of our PDB-style files is described here.)

Timeline for d4lsql1: