Lineage for d4lssl2 (4lss L:108-216)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295895Species Homo sapiens [TaxId:9606] [230172] (40 PDB entries)
  8. 1295939Domain d4lssl2: 4lss L:108-216 [235507]
    automated match to d3ngbc2
    complexed with epe, ipa, na, nag; mutant

Details for d4lssl2

PDB Entry: 4lss (more details), 2.59 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 clade a strain ker_2018_11 gp120
PDB Compounds: (L:) LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation

SCOPe Domain Sequences for d4lssl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lssl2 b.1.1.0 (L:108-216) automated matches {Homo sapiens [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

SCOPe Domain Coordinates for d4lssl2:

Click to download the PDB-style file with coordinates for d4lssl2.
(The format of our PDB-style files is described here.)

Timeline for d4lssl2: