Lineage for d4lssl1 (4lss L:3-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2033479Domain d4lssl1: 4lss L:3-107 [235506]
    automated match to d3ngbc1
    complexed with epe, ipa, na, nag; mutant

Details for d4lssl1

PDB Entry: 4lss (more details), 2.59 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 clade a strain ker_2018_11 gp120
PDB Compounds: (L:) LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation

SCOPe Domain Sequences for d4lssl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lssl1 b.1.1.0 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqspgtlslspgetaiiscrtsqygslawyqqrpgqaprlviysgstraagipdrfsg
srwgpdytltisnlesgdfgvyycqqyeffgqgtkvqvd

SCOPe Domain Coordinates for d4lssl1:

Click to download the PDB-style file with coordinates for d4lssl1.
(The format of our PDB-style files is described here.)

Timeline for d4lssl1: