SCOPe 2.05: Domain d4lssl1: 4lss L:3-107

Lineage for d4lssl1 (4lss L:3-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d4lssl1: 4lss L:3-107 [235506]
   automated match to d3ngbc1
   complexed with epe, ipa, na, nag; mutant

Details for d4lssl1

PDB Entry: 4lss, 2.59 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 clade a strain ker_2018_11 gp120

PDB Compounds: (L:) LIGHT CHAIN OF ANTIBODY VRC01 with N72T mutation

SCOPe Domain Sequences for d4lssl1:

Sequence; same for both SEQRES and ATOM records:

>d4lssl1 b.1.1.0 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqspgtlslspgetaiiscrtsqygslawyqqrpgqaprlviysgstraagipdrfsg
srwgpdytltisnlesgdfgvyycqqyeffgqgtkvqvd

Timeline for d4lssl1:

• d4lssl1 first appeared in SCOPe 2.03
  
• d4lssl1 appears in SCOPe 2.04
  
• d4lssl1 appears in SCOPe 2.06
  
• d4lssl1 appears in the current release, SCOPe 2.08