| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
Superfamily a.5.7: post-HMGL domain-like [89000] (3 families) ![]() |
| Family a.5.7.0: automated matches [227294] (1 protein) not a true family |
| Protein automated matches [227119] (2 species) not a true protein |
| Species Thermomonospora curvata [TaxId:471852] [227772] (2 PDB entries) |
| Domain d4lrtc2: 4lrt C:295-345 [235504] Other proteins in same PDB: d4lrta1, d4lrtc1 automated match to d4lrsa2 complexed with coa, gol, mg, na, pyr, so4 |
PDB Entry: 4lrt (more details), 1.5 Å
SCOPe Domain Sequences for d4lrtc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lrtc2 a.5.7.0 (C:295-345) automated matches {Thermomonospora curvata [TaxId: 471852]}
yssfllhaeraaerygvpaheilqrvgeagyvggqedmiidiavqlaeerh
Timeline for d4lrtc2: