Lineage for d4lrtc2 (4lrt C:295-345)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1260917Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1261149Superfamily a.5.7: post-HMGL domain-like [89000] (3 families) (S)
  5. 1261170Family a.5.7.0: automated matches [227294] (1 protein)
    not a true family
  6. 1261171Protein automated matches [227119] (2 species)
    not a true protein
  7. 1261175Species Thermomonospora curvata [TaxId:471852] [227772] (2 PDB entries)
  8. 1261178Domain d4lrtc2: 4lrt C:295-345 [235504]
    Other proteins in same PDB: d4lrta1, d4lrtc1
    automated match to d4lrsa2
    complexed with coa, gol, mg, na, pyr, so4

Details for d4lrtc2

PDB Entry: 4lrt (more details), 1.5 Å

PDB Description: Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site
PDB Compounds: (C:) 4-hydroxy-2-oxovalerate aldolase

SCOPe Domain Sequences for d4lrtc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lrtc2 a.5.7.0 (C:295-345) automated matches {Thermomonospora curvata [TaxId: 471852]}
yssfllhaeraaerygvpaheilqrvgeagyvggqedmiidiavqlaeerh

SCOPe Domain Coordinates for d4lrtc2:

Click to download the PDB-style file with coordinates for d4lrtc2.
(The format of our PDB-style files is described here.)

Timeline for d4lrtc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lrtc1