SCOPe 2.03: Domain d4lrtc1: 4lrt C:11-294

Lineage for d4lrtc1 (4lrt C:11-294)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (51 species)
   not a true protein

7. Species Thermomonospora curvata [TaxId:471852] [227770] (2 PDB entries)

8. Domain d4lrtc1: 4lrt C:11-294 [235503]
   Other proteins in same PDB: d4lrta2, d4lrtc2
   automated match to d4lrsa1
   complexed with coa, gol, mg, na, pyr, so4

Details for d4lrtc1

PDB Entry: 4lrt, 1.5 Å

PDB Description: Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site

PDB Compounds: (C:) 4-hydroxy-2-oxovalerate aldolase

SCOPe Domain Sequences for d4lrtc1:

Sequence; same for both SEQRES and ATOM records:

>d4lrtc1 c.1.10.0 (C:11-294) automated matches {Thermomonospora curvata [TaxId: 471852]}
prvritdstlrdgshamahqfteeqvratvhaldaagvevievshgdglggssfnygfsa
vdeidlvaaavdeavnakiavlllpgvgtvrdlkrahdagasvariathcteadvscqhf
aaarelgmetvgflmlahrigpeelarqarimvdagaqcvyvvdsagalvlsdvqarvqa
lvreigheaqvgfhghqnlslgvansvlayqngarqidgalcalgagagnspteilaatf
erlnietgvnvqaalaaaeevvrpylprlpwadraaivqgyagv

Timeline for d4lrtc1:

• d4lrtc1 is new in SCOPe 2.03-stable
  
• d4lrtc1 appears in SCOPe 2.04
  
• d4lrtc1 appears in the current release, SCOPe 2.08