| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Thermomonospora curvata [TaxId:471852] [227770] (2 PDB entries) |
| Domain d4lrtc1: 4lrt C:11-294 [235503] Other proteins in same PDB: d4lrta2, d4lrtc2 automated match to d4lrsa1 complexed with coa, gol, mg, na, pyr, so4 |
PDB Entry: 4lrt (more details), 1.5 Å
SCOPe Domain Sequences for d4lrtc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lrtc1 c.1.10.0 (C:11-294) automated matches {Thermomonospora curvata [TaxId: 471852]}
prvritdstlrdgshamahqfteeqvratvhaldaagvevievshgdglggssfnygfsa
vdeidlvaaavdeavnakiavlllpgvgtvrdlkrahdagasvariathcteadvscqhf
aaarelgmetvgflmlahrigpeelarqarimvdagaqcvyvvdsagalvlsdvqarvqa
lvreigheaqvgfhghqnlslgvansvlayqngarqidgalcalgagagnspteilaatf
erlnietgvnvqaalaaaeevvrpylprlpwadraaivqgyagv
Timeline for d4lrtc1: