Lineage for d4lrtc1 (4lrt C:11-294)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836699Species Thermomonospora curvata [TaxId:471852] [227770] (2 PDB entries)
  8. 2836702Domain d4lrtc1: 4lrt C:11-294 [235503]
    Other proteins in same PDB: d4lrta2, d4lrtc2
    automated match to d4lrsa1
    complexed with coa, gol, mg, na, pyr, so4

Details for d4lrtc1

PDB Entry: 4lrt (more details), 1.5 Å

PDB Description: Crystal and solution structures of the bifunctional enzyme (Aldolase/Aldehyde dehydrogenase) from Thermomonospora curvata, reveal a cofactor-binding domain motion during NAD+ and CoA accommodation whithin the shared cofactor-binding site
PDB Compounds: (C:) 4-hydroxy-2-oxovalerate aldolase

SCOPe Domain Sequences for d4lrtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lrtc1 c.1.10.0 (C:11-294) automated matches {Thermomonospora curvata [TaxId: 471852]}
prvritdstlrdgshamahqfteeqvratvhaldaagvevievshgdglggssfnygfsa
vdeidlvaaavdeavnakiavlllpgvgtvrdlkrahdagasvariathcteadvscqhf
aaarelgmetvgflmlahrigpeelarqarimvdagaqcvyvvdsagalvlsdvqarvqa
lvreigheaqvgfhghqnlslgvansvlayqngarqidgalcalgagagnspteilaatf
erlnietgvnvqaalaaaeevvrpylprlpwadraaivqgyagv

SCOPe Domain Coordinates for d4lrtc1:

Click to download the PDB-style file with coordinates for d4lrtc1.
(The format of our PDB-style files is described here.)

Timeline for d4lrtc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lrtc2