Lineage for d4lpac1 (4lpa C:7-113)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967083Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1243
    can form strand-exchange dimers
  4. 2967084Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 2967085Family d.97.1.1: Cell cycle regulatory proteins [55638] (5 proteins)
  6. 2967112Protein automated matches [227065] (3 species)
    not a true protein
  7. 2967116Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228797] (1 PDB entry)
  8. 2967119Domain d4lpac1: 4lpa C:7-113 [235500]
    Other proteins in same PDB: d4lpaa2, d4lpab2, d4lpac2, d4lpad2
    automated match to d4lpad_

Details for d4lpac1

PDB Entry: 4lpa (more details), 2.9 Å

PDB Description: crystal structure of a cdc6 phosphopeptide in complex with cks1
PDB Compounds: (C:) cyclin-dependent kinases regulatory subunit

SCOPe Domain Sequences for d4lpac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lpac1 d.97.1.1 (C:7-113) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
afqgrkltdqerarvlefqdsihysprysddnyeyrhvmlpkamlkvipsdyfnsevgtl
riltedewrglgitqslgwehyechapephillfkrplnyeaelraa

SCOPe Domain Coordinates for d4lpac1:

Click to download the PDB-style file with coordinates for d4lpac1.
(The format of our PDB-style files is described here.)

Timeline for d4lpac1: