SCOPe 2.07: Domain d4lnoa2: 4lno A:105-444

Lineage for d4lnoa2 (4lno A:105-444)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.0: automated matches [227250] (1 protein)
   not a true family

6. Protein automated matches [227028] (6 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries)

8. Domain d4lnoa2: 4lno A:105-444 [235488]
   Other proteins in same PDB: d4lnoa1, d4lnob1, d4lnoc1, d4lnod1, d4lnoe1, d4lnof1
   automated match to d4lnkc2
   complexed with gln, mg

Details for d4lnoa2

PDB Entry: 4lno, 2.9 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: form two of GS-1

PDB Compounds: (A:) glutamine synthetase

SCOPe Domain Sequences for d4lnoa2:

Sequence; same for both SEQRES and ATOM records:

>d4lnoa2 d.128.1.0 (A:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

Timeline for d4lnoa2:

• d4lnoa2 first appeared in SCOPe 2.03
  
• d4lnoa2 appears in SCOPe 2.06
  
• d4lnoa2 appears in the current release, SCOPe 2.08