SCOPe 2.06: Domain d4lnkd1: 4lnk D:2-104

Lineage for d4lnkd1 (4lnk D:2-104)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (4 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries)

8. Domain d4lnkd1: 4lnk D:2-104 [235483]
   Other proteins in same PDB: d4lnka2, d4lnkb2, d4lnkc2, d4lnkd2, d4lnke2, d4lnkf2
   automated match to d4lnkc1
   complexed with adp, glu, mg, so4

Details for d4lnkd1

PDB Entry: 4lnk, 2.87 Å

PDB Description: b. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of gs-glutamate-amppcp complex

PDB Compounds: (D:) glutamine synthetase

SCOPe Domain Sequences for d4lnkd1:

Sequence; same for both SEQRES and ATOM records:

>d4lnkd1 d.15.9.0 (D:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

Timeline for d4lnkd1:

• d4lnkd1 first appeared in SCOPe 2.03
  
• d4lnkd1 appears in SCOPe 2.05
  
• d4lnkd1 appears in SCOPe 2.07
  
• d4lnkd1 appears in the current release, SCOPe 2.08