Lineage for d4lnil1 (4lni L:2-104)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639568Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) (S)
    automatically mapped to Pfam PF03951
  5. 1639693Family d.15.9.0: automated matches [227156] (1 protein)
    not a true family
  6. 1639694Protein automated matches [226862] (3 species)
    not a true protein
  7. 1639695Species Bacillus subtilis [TaxId:1423] [228697] (5 PDB entries)
  8. 1639707Domain d4lnil1: 4lni L:2-104 [235477]
    Other proteins in same PDB: d4lnia2, d4lnib2, d4lnic2, d4lnid2, d4lnie2, d4lnif2, d4lnig2, d4lnih2, d4lnii2, d4lnij2, d4lnik2, d4lnil2
    automated match to d4lnkc1
    complexed with adp, mg, p3s

Details for d4lnil1

PDB Entry: 4lni (more details), 2.58 Å

PDB Description: b. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of the transition state complex
PDB Compounds: (L:) glutamine synthetase

SCOPe Domain Sequences for d4lnil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnil1 d.15.9.0 (L:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

SCOPe Domain Coordinates for d4lnil1:

Click to download the PDB-style file with coordinates for d4lnil1.
(The format of our PDB-style files is described here.)

Timeline for d4lnil1: