Lineage for d4lnia2 (4lni A:105-444)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2581287Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2581288Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2581562Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2581563Protein automated matches [227028] (6 species)
    not a true protein
  7. 2581564Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries)
  8. 2581565Domain d4lnia2: 4lni A:105-444 [235458]
    Other proteins in same PDB: d4lnia1, d4lnib1, d4lnic1, d4lnid1, d4lnie1, d4lnif1, d4lnig1, d4lnih1, d4lnii1, d4lnij1, d4lnik1, d4lnil1
    automated match to d4lnkc2
    complexed with adp, mg, p3s

Details for d4lnia2

PDB Entry: 4lni (more details), 2.58 Å

PDB Description: b. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of the transition state complex
PDB Compounds: (A:) glutamine synthetase

SCOPe Domain Sequences for d4lnia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnia2 d.128.1.0 (A:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

SCOPe Domain Coordinates for d4lnia2:

Click to download the PDB-style file with coordinates for d4lnia2.
(The format of our PDB-style files is described here.)

Timeline for d4lnia2: