![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families) ![]() automatically mapped to Pfam PF03951 |
![]() | Family d.15.9.0: automated matches [227156] (1 protein) not a true family |
![]() | Protein automated matches [226862] (5 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries) |
![]() | Domain d4lnff1: 4lnf F:2-104 [235443] Other proteins in same PDB: d4lnfa2, d4lnfb2, d4lnfc2, d4lnfd2, d4lnfe2, d4lnff2, d4lnfg2, d4lnfh2, d4lnfi2, d4lnfj2, d4lnfk2, d4lnfl2 automated match to d4lnkc1 complexed with gln, mg, po4 |
PDB Entry: 4lnf (more details), 2.95 Å
SCOPe Domain Sequences for d4lnff1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lnff1 d.15.9.0 (F:2-104) automated matches {Bacillus subtilis [TaxId: 1423]} akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf
Timeline for d4lnff1: