Lineage for d4lnfc2 (4lnf C:105-444)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2975032Family d.128.1.0: automated matches [227250] (1 protein)
    not a true family
  6. 2975033Protein automated matches [227028] (6 species)
    not a true protein
  7. 2975034Species Bacillus subtilis [TaxId:1423] [228700] (6 PDB entries)
  8. 2975067Domain d4lnfc2: 4lnf C:105-444 [235438]
    Other proteins in same PDB: d4lnfa1, d4lnfb1, d4lnfc1, d4lnfd1, d4lnfe1, d4lnff1, d4lnfg1, d4lnfh1, d4lnfi1, d4lnfj1, d4lnfk1, d4lnfl1
    automated match to d4lnkc2
    complexed with gln, mg, po4

Details for d4lnfc2

PDB Entry: 4lnf (more details), 2.95 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of GS-Q
PDB Compounds: (C:) glutamine synthetase

SCOPe Domain Sequences for d4lnfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lnfc2 d.128.1.0 (C:105-444) automated matches {Bacillus subtilis [TaxId: 1423]}
egdprnnlkrilkemedlgfsdfnlgpepefflfkldekgeptlelndkggyfdlaptdl
gencrrdivleleemgfeieashhevapgqheidfkyagavrscddiqtfklvvktiark
hglhatfmpkplfgvngsgmhcnlslfkngvnaffdenadlqlsetakhfiagivkhats
ftavtnptvnsykrlvpgyeapcyvawsaqnrspliripasrgistrvevrsvdpaanpy
lalsvllaagldgiknkleapapidrniyvmskeermengivdlpatlaealeefksnev
mvkalgehlfehfieakeiewdmfrtqvhpwereqymsqy

SCOPe Domain Coordinates for d4lnfc2:

Click to download the PDB-style file with coordinates for d4lnfc2.
(The format of our PDB-style files is described here.)

Timeline for d4lnfc2: