SCOPe 2.08: Domain d4lnfb1: 4lnf B:2-104

Lineage for d4lnfb1 (4lnf B:2-104)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.9: Glutamine synthetase, N-terminal domain [54368] (2 families)
   automatically mapped to Pfam PF03951

5. Family d.15.9.0: automated matches [227156] (1 protein)
   not a true family

6. Protein automated matches [226862] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [228697] (6 PDB entries)

8. Domain d4lnfb1: 4lnf B:2-104 [235433]
   Other proteins in same PDB: d4lnfa2, d4lnfb2, d4lnfc2, d4lnfd2, d4lnfe2, d4lnff2, d4lnfg2, d4lnfh2, d4lnfi2, d4lnfj2, d4lnfk2, d4lnfl2
   automated match to d4lnkc1
   complexed with gln, mg, po4

Details for d4lnfb1

PDB Entry: 4lnf, 2.95 Å

PDB Description: B. subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of GS-Q

PDB Compounds: (B:) glutamine synthetase

SCOPe Domain Sequences for d4lnfb1:

Sequence; same for both SEQRES and ATOM records:

>d4lnfb1 d.15.9.0 (B:2-104) automated matches {Bacillus subtilis [TaxId: 1423]}
akytredieklvkeenvkyirlqftdilgtiknveipvsqlgkaldnkvmfdgssiegfv
rieesdmylypdlntfvifpwtaekgkvarficdiynpdgtpf

Timeline for d4lnfb1:

• d4lnfb1 first appeared in SCOPe 2.03
  
• d4lnfb1 appears in SCOPe 2.07