Lineage for d4ln8i_ (4ln8 I:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778695Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 1778696Protein automated matches [227017] (23 species)
    not a true protein
  7. 1778824Species Influenza a virus [TaxId:1332244] [228093] (9 PDB entries)
  8. 1778831Domain d4ln8i_: 4ln8 I: [235432]
    Other proteins in same PDB: d4ln8b_, d4ln8d_, d4ln8f_, d4ln8h_, d4ln8j_, d4ln8l_
    automated match to d4ln8e_
    complexed with ca, nag

Details for d4ln8i_

PDB Entry: 4ln8 (more details), 2.5 Å

PDB Description: the crystal structure of hemagglutinin from a h7n9 influenza virus (a/shanghai/2/2013) in complex with lstb
PDB Compounds: (I:) Hemagglutinin

SCOPe Domain Sequences for d4ln8i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ln8i_ b.19.1.0 (I:) automated matches {Influenza a virus [TaxId: 1332244]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

SCOPe Domain Coordinates for d4ln8i_:

Click to download the PDB-style file with coordinates for d4ln8i_.
(The format of our PDB-style files is described here.)

Timeline for d4ln8i_: