SCOPe 2.03: Domain d4ln8c_: 4ln8 C:

Lineage for d4ln8c_ (4ln8 C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.0: automated matches [227246] (1 protein)
   not a true family

6. Protein automated matches [227017] (8 species)
   not a true protein

7. Species Influenza a virus [TaxId:1332244] [228093] (9 PDB entries)

8. Domain d4ln8c_: 4ln8 C: [235429]
   automated match to d4ln8e_
   complexed with ca, nag

Details for d4ln8c_

PDB Entry: 4ln8, 2.5 Å

PDB Description: the crystal structure of hemagglutinin from a h7n9 influenza virus (a/shanghai/2/2013) in complex with lstb

PDB Compounds: (C:) Hemagglutinin

SCOPe Domain Sequences for d4ln8c_:

Sequence; same for both SEQRES and ATOM records:

>d4ln8c_ b.19.1.0 (C:) automated matches {Influenza a virus [TaxId: 1332244]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

Timeline for d4ln8c_:

• d4ln8c_ is new in SCOPe 2.03-stable
  
• d4ln8c_ appears in SCOPe 2.04
  
• d4ln8c_ appears in the current release, SCOPe 2.08