| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (26 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries) |
| Domain d4llvl_: 4llv L: [235427] automated match to d4llvf_ complexed with gol, so4 |
PDB Entry: 4llv (more details), 2.39 Å
SCOPe Domain Sequences for d4llvl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4llvl_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevk
Timeline for d4llvl_: