Lineage for d4llvl_ (4llv L:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765636Domain d4llvl_: 4llv L: [235427]
    automated match to d4llvf_
    complexed with gol, so4

Details for d4llvl_

PDB Entry: 4llv (more details), 2.39 Å

PDB Description: The structure of the unbound form of anti-HIV antibody 4E10 Fv
PDB Compounds: (L:) 4E10 Fv light chain

SCOPe Domain Sequences for d4llvl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llvl_ b.1.1.0 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevk

SCOPe Domain Coordinates for d4llvl_:

Click to download the PDB-style file with coordinates for d4llvl_.
(The format of our PDB-style files is described here.)

Timeline for d4llvl_: