Lineage for d4llvb_ (4llv B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1519622Domain d4llvb_: 4llv B: [235426]
    automated match to d4llvf_
    complexed with gol, so4

Details for d4llvb_

PDB Entry: 4llv (more details), 2.39 Å

PDB Description: The structure of the unbound form of anti-HIV antibody 4E10 Fv
PDB Compounds: (B:) 4E10 Fv light chain

SCOPe Domain Sequences for d4llvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llvb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvevklvp

SCOPe Domain Coordinates for d4llvb_:

Click to download the PDB-style file with coordinates for d4llvb_.
(The format of our PDB-style files is described here.)

Timeline for d4llvb_: